CAMPSQ931
Title : Tachystatin-C
GenInfo Identifier : 150387846
Source : Tachypleus tridentatus [Japanese horseshoe crab]
Taxonomy : Animalia
UniProt: P0C200
PubMed : 10473569
Length : 41
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : Escherichia coli ( IC50 = 1.2 microg/ml ), Staphylococcus aureus ( IC50 = 0.8 microg/ml ), Candida albicans ( IC50 = 0.9 microg/ml ), Pseudomonas pastoris ( IC50 = 0.3 microg/ml )
Validated : Experimentally Validated
AMP Family : Tachystatin
Signature :
ID Type Pattern / HMM T. Length
CAMPTacH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0019835 Biological Process Cytolysis IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0044179 Biological Process Hemolysis in other organism IEA
Sequence:
DYDWSLRGPPKCATYGQKCRTWSPPNCCWNLRCKAFRCRPR