CAMPSQ945
Title : Cp-thionin-2
GenInfo Identifier : 114152286
Source : Vigna unguiculata [Cowpea]
Taxonomy : Viridiplantae
UniProt: P84920
PubMed : 16824043
Length : 46
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : Staphylococcus aureus ATTC 25923 ( MIC = 128 mg/ml) , Escherichia coli ATTC 25922 ( MIC = 64 mg/ml) , Pseudomonas syringae ( MIC = 42 mg/ml)
Validated : Experimentally Validated
Comment : Inactive against Ralstonia solanacearum, Rhataybacter sp.,Erwinia sp.
Pfam : PF00304 : ( Gamma-thionin family )
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
KTCMTKKEGWGRCLIDTTCAHSCRKYGYMGGKCQGITRRCYCLLNC