CAMPSQ979
Title : Cathelin-related antimicrobial peptide
GenInfo Identifier : 1706115
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: P51437
PubMed : 9148921
Length : 38
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : Escherichia coli ATCC 25922 (MIC = 1microM), Escherichia coli ML35 (MIC = 2microM), Escherichia coli D21 (MIC = 8microM), Pseudomonas aeruginosa ATCC 27853 (MIC = 4microM), Serratia marcescens ATCC 8100 (MIC = 4microM), Staphylococcus aureus ATCC 25923 (MIC = 32microM), Staphylococcus aureus Cowan I (MIC = 32microM), Staphylococcus aureus (MRSA) (MIC > 64microM), Staphylococcus aureus MRSA (MIC = 64 microM), Staphylococcus epidermidis ATCC 12228 (MIC = 16 microM) , Streptococcus faecalis ATCC 29212 (MIC = 16 microM) , Bacillus megaterium Bm11 (MIC = 4 microM) , Candida albicans (MIC > 64 microM) , Cryptococcus neoformans (MIC = 16 microM)
Validated : Experimentally Validated
Pfam : PF12153 : ( LPS binding domain of CAP18 (C terminal) )
PF00666 : ( Cathelicidin )
InterPro : IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
IPR022746 : Cathlecidin_C.
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM T. Length
CAMPCatH HMM Variable
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042581 Cellular Component Specific granule IDA
GO:0050829 Biological Process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological Process Defense response to Gram-positive bacterium IMP
GO:0051873 Biological Process Killing by host of symbiont cells IMP
GO:0044130 Biological Process Negative regulation of growth of symbiont in host IMP
GO:0044140 Biological Process Negative regulation of growth of symbiont on or near host surface IMP
Sequence:
ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE