CAMPSQ989
Title : Ostricacin-2
GenInfo Identifier : 145566912
Source : Struthio camelus [Ostrich]
Taxonomy : Animalia, Aves
UniProt: P85114
PubMed : 16459058
Length : 41
Activity : Antibacterial, Antifungal
Gram Nature : Gram+ve, Gram-ve
Target : S.aureus 1056 MRSA (MIC=1.25 microg/ml), E.coli O157:H7 (MIC=0.96 microg/ml) , C.albicans 3153A ( MIC = 6.20 microg/ml)
Validated : Experimentally Validated
Pfam : PF00711 : ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0042742 Biological Process Defense response to bacterium IEA
GO:0050832 Biological Process Defense response to fungus IEA
GO:0031640 Biological Process Killing of cells of other organism IEA
Sequence:
APGNKAECEREKGYCGFLKCSFPFVVSGKCSRFFFCCKNIW